Recovery Research Peptide
TB-500 10mg is a research-grade peptide selected for Eira London’s Recovery Research category.
It sits within the study of cellular repair and regeneration, cytoskeletal and tissue-remodelling research and the wider conversation around recovery-focused peptide science. As part of Eira London’s Recovery Research range, TB-500 reflects our focus on premium presentation, clear product information and responsible research standards.
Eira London supplies research-grade peptides for research purposes only, with a focus on transparency, batch integrity and quality-led sourcing.
Store according to the storage guidance provided with the product.
Keep sealed until required for research handling. Always refer to the product packaging and batch documentation for specific storage and handling information.
This product is supplied for research purposes only.
It is not intended for human consumption, medical use, diagnosis, treatment, prevention or cure of any disease. Eira London does not provide dosage, administration or personal-use guidance.
This product is supplied for research purposes only and is not intended for human consumption, medical use, or any other non-research application.
All compounds are research-grade and supplied with available batch documentation.
Storage: Store at −20°C for long-term stability. Stable at 4°C for short-term use.
Handling: For research use only. Handle under appropriate laboratory conditions.
Cold-chain: All Eira compounds are stored and shipped under cold-chain conditions to preserve integrity.
Eira London products are supplied for research purposes only. They are not intended for human consumption, medical use, diagnosis, treatment, prevention or cure of any disease.
Independent reviews find roughly 40% of peptide sellers raise at least one major red flag — missing COAs, fabricated purity numbers, vanishing support. Here’s how we compare on the things that actually protect you.
Comparison reflects common practices across the research-peptide market; individual sellers vary.
| Type | Thymosin β4 (Tβ4) peptide |
|---|---|
| CAS Number | 77591-33-4 |
| Molecular Weight | 4963 g/mol |
| Amino Acids | 43 |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Formula | C212H350N56O78S |
Tβ4 is a naturally occurring actin-sequestering peptide, and in vitro research studies its role in cytoskeletal dynamics and cell migration — processes central to tissue-repair research.
Animal-model research reports associations with angiogenesis, cell migration and wound-repair outcomes, a focus of regenerative and recovery research.
Tβ4 is studied within cardiac and tissue-remodelling research models.
Research use only. The above summarises published scientific research and is not a claim about human use, treatment, or outcomes.
Not for human consumption. Eira London products are supplied for research purposes only. They are not intended for human consumption, medical use, diagnosis, treatment, prevention or cure of any disease.
The research summaries and references on this page are provided for educational reference only. They describe published scientific research and do not constitute medical advice or a product claim. By purchasing, you confirm you are a qualified researcher and will use this product in accordance with all applicable laws and regulations.
Orders placed before the daily cutoff are dispatched within 24 hours, Monday to Friday, by tracked UK courier — typically 2–3 working days, with a next-day option at checkout.
Every order ships with the lyophilised vial, a tamper-evident seal, and a packing slip referencing the batch ID. The matching certificate of analysis is on this page and available on request.
Every batch is tested by an independent third-party lab using HPLC, and the batch-specific certificate of analysis reports the measured purity — we won't list a compound that falls below our threshold.
Lyophilised, store at -20°C in a dry, dark place. Once reconstituted, keep refrigerated at 2–8°C. Full storage and handling notes are listed on this page.
Secure card payment (Visa, Mastercard, Amex) alongside PayPal and Google Pay — never crypto-only. Every order is processed over an encrypted checkout.
Unopened, intact items can be returned — just contact us with your order reference. For any quality concern we'll always make it right. Opened vials can't be returned, for integrity reasons.
We currently dispatch within the UK. For international research enquiries, contact our team and we'll advise on what's possible.
No. Every Eira compound is supplied strictly for laboratory research use only — not for human or animal consumption, medical use, or self-administration.
Eira London supplies research-grade compounds strictly for research purposes only. Our products are not for human consumption, medical use, diagnosis, treatment or prevention of any disease, and this site is intended for adults only.
I am under 18 — take me away
