How we test Verify a batch How to judge a supplier
Eira London supplies TB-500 (also written TB500) in the UK as a 10 mg vial of lyophilised research peptide, with an independent HPLC certificate for every batch and tracked UK delivery.
TB-500 is a 43-amino-acid peptide based on thymosin β4 (Tβ4). Molecular weight 4,963 g/mol; molecular formula C212H350N56O78S; CAS 77591-33-4. The full sequence is listed in the technical specifications on this page. It belongs to our Protein-Derived Peptides range with BPC-157, and both appear in the GLOW blend.
Each TB-500 batch is tested by an independent laboratory using HPLC. The current batch’s certificate is shown on this page: purity, lot number, labelled and measured amount, and test date. Every published TB-500 batch, each with its PDF, is listed on the TB-500 certificate of analysis page, and any lot can be checked in the COA lookup. How we test.
Supplied as a lyophilised (freeze-dried) powder in a sealed 10 mg vial. Store sealed at −20 °C, protected from light and moisture, and avoid repeated freeze-thaw cycles. Orders ship cold-chain with gel packs by tracked UK delivery from Eira London Limited, a UK-registered company.
For laboratory research use only. Not for human consumption. Eira London does not provide dosage, administration or personal-use guidance.
This product is supplied for research purposes only and is not intended for human consumption, medical use, or any other non-research application.
All compounds are research-grade and supplied with available batch documentation.
Storage: Store at −20°C for long-term stability. Stable at 4°C for short-term use.
Handling: For research use only. Handle under appropriate laboratory conditions.
Cold-chain: All Eira compounds are stored and shipped under cold-chain conditions to preserve integrity.
Eira London products are supplied for research purposes only. They are not intended for human consumption, medical use, diagnosis, treatment, prevention or cure of any disease.
Independent reviews find roughly 40% of peptide sellers raise at least one major red flag — missing COAs, fabricated purity numbers, vanishing support. Here’s how we compare on the things that actually protect you.
Comparison reflects common practices across the research-peptide market; individual sellers vary.
| Type | Thymosin β4 (Tβ4) peptide |
|---|---|
| CAS Number | 77591-33-4 |
| Molecular Weight | 4963 g/mol |
| Amino Acids | 43 |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Formula | C212H350N56O78S |
Tβ4 is a naturally occurring actin-sequestering peptide; in vitro research studies its role in cytoskeletal dynamics and cell migration.
Animal-model research examines Tβ4 within angiogenesis and cell-migration endpoints.
Tβ4 is studied within tissue-remodelling research models.
Research use only. The above summarises published scientific research and is not a claim about human use, treatment, or outcomes.
Not for human consumption. Eira London products are supplied for research purposes only. They are not intended for human consumption, medical use, diagnosis, treatment, prevention or cure of any disease.
The research summaries and references on this page are provided for educational reference only. They describe published scientific research and do not constitute medical advice or a product claim. By purchasing, you confirm you are a qualified researcher and will use this product in accordance with all applicable laws and regulations.
TB-500 is a thymosin β4 (Tβ4) peptide with the sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids). Molecular weight: 4963 g/mol. CAS 77591-33-4.
99.73% purity by third-party HPLC on lot JAN-121722, tested 17 Mar 2026. Labelled 10 mg; measured 10.99 mg. The certificate of analysis is on this page.
Orders ship by tracked UK courier — typically 2–3 working days, with a next-day delivery option at checkout.
Every order ships with the lyophilised vial, a tamper-evident seal, and a packing slip referencing the batch ID. The matching certificate of analysis is on this page and available on request.
Every batch is tested by an independent third-party lab using HPLC, and the batch-specific certificate of analysis reports the measured purity — we won't list a compound that falls below our threshold.
Lyophilised, store at -20°C in a dry, dark place. Once reconstituted, keep refrigerated at 2–8°C. Full storage and handling notes are listed on this page.
Secure card payment (Visa, Mastercard, Amex) alongside PayPal and Google Pay — never crypto-only. Every order is processed over an encrypted checkout.
Unopened, intact items can be returned — just contact us with your order reference. For any quality concern we'll always make it right. Opened vials can't be returned, for integrity reasons.
We currently dispatch within the UK. For international research enquiries, contact our team and we'll advise on what's possible.
No. Every Eira compound is supplied strictly for laboratory research use only — not for human or animal consumption, medical use, or self-administration.
Eira London supplies products strictly for research use only. They are not for human use, and this site is intended for adults only.
I am under 18 — take me away
