Certificate of analysis
TB-500 certificate of analysis
Lot JAN-121722, the TB-500 batch currently shipping, tested at 99.73% purity by third-party HPLC on 17 Mar 2026. The vial is labelled 10 mg; the laboratory measured 10.99 mg.
Batch history
Every published TB-500 certificate. Batches marked Current are the ones shipping now.
| Lot | HPLC purity | Labelled | Measured | Tested | Certificate |
|---|---|---|---|---|---|
| JAN-121722 Current | 99.73% | 10 mg | 10.99 mg | 17 Mar 2026 |
Reference data
TB-500 compound data, for comparison with the certificate.
- Type
- Thymosin β4 (Tβ4) peptide
- CAS number
- 77591-33-4
- Molecular formula
- C212H350N56O78S
- Molecular weight
- 4963 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES